FWSŢP´ @ C˙˙˙?˝ˆ+/'_rootCreate a temporary Access-List entryaccess-enableenableCaddSCaccess-templatemanage archive filesarchiveChange current directorycdReset functionsclearClear access list statistical informationaccess-listClear access list counterscountersAccess list number<1-199>Access list number (expanded range)<1300-2699>Access list nameWORDClear counters on one or all interfacesFastEthernet IEEE 802.3FastEthernetFastEthernet interface number<0-2>GigabitEthernet IEEE 802.3zGigabitEthernetGigabitEthernet interface numberTerminal lineLineFirst Line number<0-16>Last Line number<1-16>Primary terminal lineconsole<0-0>Virtual terminalvty<0-15><1-15>Null interfaceNullNull interface numberEthernet Channel of interfacesPort-channelPort-channel interface number<1-6>Catalyst VlansVlanVlan interface number<1-1001>Delete host table entrieshostHostname to delete (* for all entries)Clear the hardware logic on an interfaceinterfaceIPipClear IP accounting databaseaccountingClear IP accounting checkpoint databasecheckpointClear NATnatClear translation statisticsstatisticsClear dynamic translationtranslationDelete all dynamic translations*Inside addresses (and ports)insideGlobal IP addressA.B.C.DLocal IP addressOutside addresses (and ports)outsideTransmission Control ProtocoltcpUser Datagram ProtocoludpRedirect cacheredirectReset a terminal linelineLine numberClear logging bufferloggingMAC forwarding tablemac-address-tabledynamic entry typedynamicaddress keywordaddress48 bit mac addressH.H.Hinterface keywordvlan keywordvlanvlan number<0-4096>Clear MAC notification Global CountersnotificationClear a TCP connection or statisticsTTY lineLocal host address/portlocalLocal host name or IP addressHostname or A.B.C.DLocal TCP port<1-65535>Remote host address/portremoteRemote host name or IP addressRemote TCP portTCP protocol statisticsManage the system clockclockcluster exec mode commandsclusterEnter configuration modeconfigureConfigure from NV memorymemoryConfigure from a TFTP network hostnetworkURL of source fileflash:ftp:null:nvram:rcp:system:tftp:xmodem:ymodem:zflash:Overwrite NV memory from TFTP network hostoverwrite-networkConfigure from the terminalterminalOpen a terminal connectionconnectIP address or hostname of a remote systemCopy from one file to anothercopyErase destination file system./eraseCopy from flash: file systemCopy to flash: file systemCopy to ftp: file systemCopy to null: file systemCopy to nvram: file systemCopy to rcp: file systemUpdate (merge with) current system configurationrunning-configCopy to startup configurationstartup-configCopy to system: file systemCopy to tftp: file systemCopy to xmodem: file systemCopy to ymodem: file systemCopy to zflash: file systemCopy from ftp: file systemCopy from null: file systemCopy from nvram: file systemCopy from rcp: file systemCopy from current system configurationCopy from startup configurationCopy from system: file systemCopy from tftp: file systemCopy from xmodem: file systemCopy from ymodem: file systemCopy from zflash: file systemDebugging functions (see also 'undebug')debugDelete a filedeleteList files on a filesystemdirTurn off privileged commandsdisableDisconnect an existing network connectiondisconnectIEEE 801.1X commandsdot1xTurn on privileged commandsenableErase a filesystemeraseErase all files(in NVRAM)/allFilesystem to be erasedErase contents of configuration memoryExit from the EXECexitFormat a filesystemformatFsck a filesystemfsckDescription of the interactive help systemhelpLock the terminallockLog in as a particular userloginlogoutCreate new directorymkdirDisplay the contents of a filemoreName an existing network connectionname-connectionDisable debugging functionsnoSend echo messagespingPing destination address or hostnameIP echoTag encapsulated IP echotagDisplay current working directorypwdRun command on remote switchrcommandHalt and perform a cold restartreloadRename a filerenameResume an active network connectionresumeRemove existing directoryrmdirExecute a remote commandrshSend a message to other tty linessendRun the SETUP command facilitysetupShow running system informationshowList access listsaccess-listsACL number<1-2699>ACL nameARP tablearpshow boot attributesbootBuffer pool statisticsbuffersCDP informationcdpInformation for specific neighbor entryentryall CDP neighbor entriesProtocol informationprotocolVersion informationversionName of CDP neighbor entryCDP interface status and configurationCDP neighbor entriesneighborsShow detailed informationdetailCDP statisticstrafficShow QoS Class Mapclass-mapclass-map nameDisplay the system clockDisplay detailed informationContents of Non-Volatile memoryconfigurationInterface controller statuscontrollersShow Ethernet Controller infoethernet-controllerShow filesystem informationfileList open file descriptorsdescriptorsList file informationinformationFile pathList filesytemssystemsdisplay information about flash: file systemDisplay the session command historyhistoryIP domain-name, lookup style, nameservers, and host tablehostsHostname for specific informationInterface status and configurationinterfacesShow interface accountingShow interface countersShow interface broadcast suppression discard countersbroadcastShow interface error counterserrorsLimit display to interfaces on modulemoduleModule number<1-9>Show interface multicast suppression discard countersmulticastShow interface trunk counterstrunkShow interface unicast suppression discard countersunicastShow interface routing/bridging infocrbShow interface descriptiondescriptionShow interface etherchannel informationetherchannelShow interface Weighted Fair Queueing (WFQ) infofair-queueirbShow interface MAC accounting infomac-accountingShow interface precedence accounting infoprecedenceShow interface trunk VTP pruning informationpruningShow interface Weighted Random Early Detection (WRED) inforandom-detectShow interface rate-limit inforate-limitShow interface Traffic Shape infoshapeShow interface packets & octets, in & out, by switching pathstatsShow interface line statusstatusShow interface error disabled stateerr-disabledShow interface switchport informationswitchportShow interface trunk informationIP informationList IP access listsIP ARP table48-bit hardware address of ARP entryIP address or hostname of ARP entryIP interface status and configurationBrief summary of IP status and configurationbriefVTP Vlan StatusTTY line informationFirst Line rangeLast Line rangeQuick line status summarysummaryMAC configurationmacMAC access-groupaccess-groupaging-time keywordaging-timecount keywordcountmulticast info for selected wildcardCount KeywordAddresses learned by IGMP Snoopingigmp-snoopingUser entered(static) addressesuserMAC notification parameters and history tableNotification flags for an interfacestatic entry typestatic<1-1005>Memory statisticsShow MultiLayer Switching informationmlsCurrent operating configurationShow interface configurationShow map class informationmap-classInformation about Telnet connectionssessionsSpanning tree topologyspanning-treeReport on active interfaces onlyactiveShow spanning tree backbonefast statusbackbonefastShow blocked portsblockedportsStatus and configuration of this bridgebridgeMac address of this bridgeBrief summary of the status and configuration outputForward delay intervalforward-timeHello timehello-timeMax agemax-ageBridge priority of this bridgeprioritySpanning tree protocolBrief summary of interface informationUse wide output formatwideShow inconsistent portsinconsistentportsSpanning Tree interface status and configurationShow Spanning pathcost optionspathcostStatus and configuration of the root bridgerootSummary of port statesShow spanning tree uplinkfast statusuplinkfastVLAN Switch Spanning TreesContents of startup configurationOutput modifiers|System hardware and software statusVTP VLAN statusVTP all VLAN status in briefVTP VLAN status by VLAN ididSNMP ifIndexifIndexVTP VLAN status by VLAN namenamePrivate VLAN informationprivate-vlanRemote SPAN VLANsremote-spanDisplay information about terminal linessystatOpen a telnet connectiontelnetEnable telnet debugging mode/debugEnable telnet line mode/lineDisable local echo/noechoSuppress login/logout messages/quietEnable telnet source route mode/route:Specify source interface/source-interfaceEnable stream processing/streamPort number<0-65535>Echo (7)echoTelnet (23)Set terminal line parametersTest subsystems, memory, and interfacestestTrace route to destinationtracerouteOpen a tunnel connectiontunnelUDLD protocol commandsudldDisable debugging functions (see also 'debug')undebugVerify a fileverifyConfigure VLAN parametersConfigure VLAN databasedatabaseExit mode without applying the changesabortVMPS actionsvmpsList active connectionswhereWrite running configuration to memory, network, or terminalwriteErase NV memoryWrite to NV memoryWrite to network TFTP serverURL of destination fileWrite to terminalenter<100-199>any<2000-2699>arp-cachetablepagpradiustcb<0x0-0xFFFFFFFF>vtpaaaadministrativeauthenticationauthorizationper-useralladjacencyeventspacketsdiscoveryextendedhsrphttppacketmemberssnmpvqpxycondition<1-1000>calledcallingcard<1-2>usernamecsufcustom-queuedhcpdomainrepliesauthsmbackendbesmcorereauthsmdtpaggregationdecisionoserrsqueuestatestimerserroreventidblinecardethernet-interfacegigastackLoopback<0-2147483647>ftphtmlformspagesssitokensezsetuptransactionsurlicmpigsngroupmanagementroutertimerroute-cachempacketfastswitch<1-99>detailedportpeersecuritysocketdriverdriver-pakheader-compressionrcmdsacktempacllist<0-2699>mac-notificationmatmmodemmonitoridb-updatenotificationsplatformrequestsmvrdbgigmpsnportsntpadjustloopfilterparamsrefclockselectsyncvaliditynvramfsmmiscpmassertcookiesetherchnlmessagesregistryscpsmspansplitvpport-securityrtrtraceheadersspan-sessionexceptionsbpdureceivetransmitbpdu-optconfiggeneralpvst+switchstatetxsw-vlanbadpmcookiesifsaccfwdchangeallowedvlancfgchangefwdchangelinkchangemodechangepruningcfgchangestatechangeregistriesxmitasiccpuifffpfiltermgripoptionledvectorvmpostcleanupinitturbocleanupturboinitturbosendprotectedstratavqpctacacstemplatetftpxcvrflowcontrolfn-entryforcedfunctioninit-seqlink-statusreadshow-controllerspeedaliasescalqosclassmapcalqospolicymapcalqospolicymapclassconfig-rtr-httpexecinsenaclinssnaclipenaclipnat-poolipsnaclmac-enaclmap-listnull-interfacepreauthqosclassmapqospolicymapqospolicymapclasssg-radiussg-tacacs+subinterfacetrangevc-class<0-FFFFFFFF>dumpheaderassignedfailuresfreeinput-interfaceoldpoolcandidatesmac-addressdebuggingleaseserverenvfanerrdisabledetectflap-valuesrecoveryload-balanceport-channelexceptioncommandLINEnamesoptionsl2shortnamesaccess-violationsoutput-packetsigmpsnoopingmroutertranslationsverboseredirectssocketslocation<0-4294967294>allocating-processtotalsdeadallocfastiomultibuspciprocessormasksqospolicersmapscos-dscpdscp-cossession<1-1>mvrassociationsinternalneighborpolicy-mapclassprivilegeprocessescpu<1-4294967295>queueingcustomfairrhostsrmonalarmsrpsapplicationcollection-statistics<1-2147483647>distributions-statisticsfulltabularoperational-statereaction-triggerrespondertotals-statisticsengineIDcostinconsistencyportfastrootcostmethodstacks<1-8192>standby<0-255>storm-controlsubsyskernellibrarysystemmtutech-supportpagepasswordtime-rangeuserswrr-queuebandwidthcos-map–”‚ć– –R– –R– –R–  –R–   –R–   – N–R– – N– N–R– – N– N–N–R– – N– N–N–R– – N– N–N–R– – N–R– – N–N–R– – N–N–N–R– – N–N–R– – N–N–N–R– – N–N–R–  !– N–N–N–R– "#– N–N–N–!N–R– $%– N–N–N–R–  &– N–N–N–%N–R– '(– N–N–N–R–  )– N–N–N–(N–R– "*– N–N–N–(N–)N–R– +,– N–N–R– -&– N–N–,N–R– ./– N–N–R– 01– N–N–/N–R– 23– N–N–R– 45– N–N–3N–R– 67– N–R– 8– N–7N–R– 9:– N–R– – N–:N–R– – N–:N–N–R– – N–:N–R– – N–:N–N–R– +,– N–:N–R– -&– N–:N–,N–R– ./– N–:N–R– 01– N–:N–/N–R– 23– N–:N–R– 45– N–:N–3N–R– ;<– N–R– =>– N–N–R– AB– N––óN– +N–R– -–óN– +N–R– . /–óN– +N–N–R– 0 1–óN– +N–N–R– 2 3–óN– +N–N–R– 4 5–óN– +N–N– 3N–R– 6 7–óN– +N–N–R– 8 9–óN– +N–N–R– : ;–óN– +N–N–R– < =–óN– +N–R– > ?–óN– +N–R– @ A–óN– +N–R– 2 3–óN– +N– AN–R– 4 5–óN– +N– AN– 3N–R– B C–óN– +N–R– < D–óN– +N–R– E F–óN– +N–R– G H–óN– +N–R– I J–óN– +N–R– 2 3–óN– +N– JN–R– 4 5–óN– +N– JN– 3N–R– K L–óN– +N–R– M N–óN– +N–R– O P–óN– +N–R– Q R–óN– +N–R– S T–óN– +N–R– U V–óN– +N– TN–R– 2 3–óN– +N– TN–R– 4 5–óN– +N– TN– 3N–R– W X–óN– +N–R– 2 3–óN– +N– XN–R– 4 5–óN– +N– XN– 3N–R– Y 9–óN– +N–R– 2 3–óN– +N– 9N–R– 4 5–óN– +N– 9N– 3N–R– Z<–óN–R– [ő–óN–N– íO–– N–N–@N– íO–– N–N– íO––ŮN–˛N– řN– ůN– íO––ŮN–˛N– řN– úN– íO––ŮN–˛N– řN– űN– íO––ŮN–˛N– řN– üN– íO––ŮN–˛N– ýN– íO––ŮN–˛N–úN– íO––ŮN–˛N– N– ţN– íO––ŮN–˛N– N– ˙N– íO––ŮN–˛N– N–N– íO––ŮN–˛N–N– íO––óN– ¤N– íO––óN– ¤N– ĽN– íO––óN– ¤N– ŚN– íO––óN– ¤N– §N– íO––óN– ¤N– ¨N– íO––óN– ¤N–|N– íO––óN– ¤N– ŠN– íO––óN– ¤N– ŞN– íO––óN– ¤N– ŤN– íO––óN– ¤N–:N– íO––óN– ¤N–:N– íO––óN– ¤N– ŹN– íO––óN– ¤N– ­N– íO––óN– ¤N– ŽN– íO––óN– ¤N–WN– íO––óN– ¤N– ŻN– íO––óN– ¤N– ‚N– íO––óN– ¤N– °N– íO––óN– ¤N– ąN– íO––óN– ¤N– ˛N– íO––óN– ¤N– łN– íO––óN– ¤N– ´N– íO––óN– ¤N– ľN– íO––óN– ¤N– kN– íO––óN– ¤N– śN– íO––óN– ¤N– ˇN– íO––óN– ¤N– ¸N– íO––óN– ¤N– ˜N– íO––óN– ¤N– šN– íO––óN– ¤N– şN– íO––óN–úN– íO––óN–üN– íO––óN–ţN– íO––óN–ţN–`N– ťN– íO––óN–ţN–`N– ťN– źN– íO––óN–ţN–`N– ťN– ˝N– íO––óN–ţN–`N– ťN– N– íO––óN–ţN– ýN– íO––óN–ţN– ýN– źN– íO––óN–ţN– ýN– ˝N– íO––óN–ţN– ýN– N– íO––óN–ţN– žN– íO––óN–ţN– žN– źN– íO––óN–ţN– žN– ˝N– íO––óN–ţN– žN– N– íO––óN–ţN– żN– íO––óN–ţN– ŔN– íO––óN–ţN– ŔN– źN– íO––óN–ţN– ŔN– ˝N– íO––óN–ţN– ŔN– N– íO––óN–ţN– ÁN–,N–&N– íO––óN–ţN– ÁN–,N–&N– źN– íO––óN–ţN– ÁN–,N–&N– ˝N– íO––óN–ţN– ÁN–,N–&N– N– íO––óN–ţN– ÁN–/N–1N– íO––óN–ţN– ÁN–/N–1N– źN– íO––óN–ţN– ÁN–/N–1N– ˝N– íO––óN–ţN– ÁN–/N–1N– N– íO––óN–ţN– ÁN–3N–5N– íO––óN–ţN– ÁN–3N–5N– źN– íO––óN–ţN– ÁN–3N–5N– ˝N– íO––óN–ţN– ÁN–3N–5N– N– íO––óN–ţN– ÂN– íO––óN–ţN– ÂN– źN– íO––óN–ţN– ÂN– ˝N– íO––óN–ţN– ÂN– N– íO––óN–ţN– ĂN–N– íO––óN–ţN– ĂN–N– źN– íO––óN–ţN– ĂN–N– ˝N– íO––óN–ţN– ĂN–N– N– íO––óN– N– íO––óN– N– N–HN– íO––óN– N– N–HN– N– íO––óN– N– N–HN– N– íO––óN– N– N–N– íO––óN– N– N–N– N– íO––óN– N– N–N– N– íO––óN– N–:N– íO––óN– N–:N–/N–1N– íO––óN– N–:N–3N–5N– íO––óN– N– N– íO––óN– N– N–3N–5N– íO––óN– N– N– N– íO––óN– N– N– íO––óN– N– íO––óN– N–N– íO––óN–xN– íO––óN–xN– N– íO––óN–zN– íO––óN–zN– ÄN– íO––óN–zN– ÄN– N– íO––óN–zN– ÄN– ĹN–bN– íO––óN–zN– ÄN– ĹN–bN– N– íO––óN–zN– N– íO––óN–zN– N–)N– íO––óN–zN– N– N– íO––óN– N– íO––óN– N– íO––óN– N– N– íO––óN– ĆN– íO––óN– ĆN– N– íO––óN– ĆN– N– N– íO––óN– ĆN– N– ýN– íO––óN– N– ÇN– íO––óN– N– ČN– íO––óN–źN– íO––óN–źN–DN– íO––óN– N–:N– íO––óN– N–:N–,N–&N– íO––óN– N–:N–/N–1N– íO––óN– N–:N–3N–5N– íO––óN– ÉN– ýN– íO––óN– ÉN– ĘN– íO––óN– ËN– ĚN– íO––óN– ËN– ÍN– íO––óN– ËN– ÎN– íO––óN– AN– aN– íO––óN– AN– N– íO––óN– AN– ĎN– íO––óN– AN– =N– íO––óN– AN– ĐN– íO––óN– AN– hN– íO––óN– ŃN– íO––óN– N– N– íO––óN– N– N–‚N– íO––óN– N– N–ƒN– íO––óN– N– N–„N– íO––óN– N– N–…N– íO––óN– N– N–†N– íO––óN– N– N–‡N– íO––óN– N– N–ˆN– íO––óN– N– N–‰N– íO––óN– N– N–ŠN– íO––óN– N– N–‹N– íO––óN– N– #N– íO––óN–‚N– íO––óN– &N– íO––óN– (N– íO––óN– (N–N– íO––óN– *N– 3N– ŇN– ÓN– íO––óN– *N– 3N– pN– íO––óN– *N– 3N– ÔN– íO––óN– *N– 3N– ŐN– íO––óN– *N– 3N– SN– íO––óN– *N– 3N– SN– ÖN– íO––óN– *N– =N– ŇN– ÓN– íO––óN– *N– =N– pN– íO––óN– *N– =N– ÔN– íO––óN– *N– =N– ŐN– íO––óN– *N– =N– ×N– íO––óN– +N– íO––óN– +N–,N–&N– íO––óN– +N–/N–1N– íO––óN– +N–3N–5N– íO––óN– +N–>N– íO––óN– +N–N– íO––óN– +N–N– /N– íO––óN– +N–N– 1N– íO––óN– +N–N– 3N– 5N– íO––óN– +N–N– 7N– íO––óN– +N–N– 9N– íO––óN– +N–N– ;N– íO––óN– +N– =N– íO––óN– +N– ?N– íO––óN– +N– AN– íO––óN– +N– AN– 3N– 5N– íO––óN– +N– CN– íO––óN– +N– DN– íO––óN– +N– FN– íO––óN– +N– HN– íO––óN– +N– JN– íO––óN– +N– JN– 3N– 5N– íO––óN– +N– LN– íO––óN– +N– NN– íO––óN– +N– PN– íO––óN– +N– RN– íO––óN– +N– TN– íO––óN– +N– TN– VN– íO––óN– +N– TN– 3N– 5N– íO––óN– +N– XN– íO––óN– +N– XN– 3N– 5N– íO––óN– +N– 9N– íO––óN– +N– 9N– 3N– 5N– íO––óN–N– íO––óN–N– ŘN– íO––óN–N–@N– íO––óN–N– ŮN– íO––óN–